DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:302 Identity:71/302 - (23%)
Similarity:117/302 - (38%) Gaps:72/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQN-----------------------------PW 49
            |..::|..|.:|:.|..:|:   .|.:||..|::                             ||
Mouse   138 LQEKLQSSQSILKRDASLPY---LREMNAAQAEHILNSDCGSGMEYPPIARIADGKPADKASWPW 199

  Fly    50 MAYLETPKGFH-CSGTLINHLFVLTAAHC---VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQE 110
            .:.|:. :|.| |..:||...:::|:|||   ..:..|.||..|            .....|...
Mouse   200 QSSLQV-EGIHLCGASLIGSQWLVTSAHCFDNYKNPKLWTVSFG------------RTLSSPLTT 251

  Fly   111 YNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE-PIDQLTWFTTTVWRE 174
            ..|:....|..|.::...:||.:::|...|.:..::..:|: ....||. |..::   ..|.|..
Mouse   252 RKVESIIVHENYASHKHDDDIAVVKLSSPVLFSENLHRVCL-PDATFQVLPKSKV---FVTGWGA 312

  Fly   175 TAANAT-SKVLRTMNIDRQPKETCSE--IYGWNMTFEQICAGNTLSQL--CSTDSGAPQI----R 230
            ..||.. ...|:.:.|:....:.|::  :||..::...||||....:|  |..|||.|.:    |
Mouse   313 LKANGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFLTGKLDACEGDSGGPLVISDNR 377

  Fly   231 KMWHNGSDRYVQLGIAS--RVKGQCQNSGILMDLLSYADWIK 270
            ..|:       .|||.|  ...|:....||...:..|.||||
Mouse   378 NKWY-------LLGIVSWGIDCGKENKPGIYTRVTHYRDWIK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/239 (26%)
Tryp_SPc 48..269 CDD:214473 58/236 (25%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699 1/3 (33%)
Tryp_SPc 185..411 CDD:214473 58/249 (23%)
Tryp_SPc 186..414 CDD:238113 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.