DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31205

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:286 Identity:59/286 - (20%)
Similarity:116/286 - (40%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCGIPHNISERSVN-----AKLAQNPWMAYL--ETPKGFH---CSGTLINHLFVLTAAHCVPDD 81
            ::|||   .:|:..|     |:..::||:..:  .|..|.:   |:|.||:...|:||||||..|
  Fly    27 QECGI---FNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKD 88

  Fly    82 ---LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR---HRYYNANDQTNDIGMLRLGRRV 140
               .:..|..|:.::.                 |:::...   |..|:.....||:.::.|.:.|
  Fly    89 ESESIYGVVFGDSDSS-----------------NINLVSAVTVHPDYSPRKFENDLAIIELTKEV 136

  Fly   141 EYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVL--------------RTMNIDR 191
            .:.:.::|||:       ..:.::...:.|        :.||::              .|..:|:
  Fly   137 VFSDLVQPICL-------PSVSEMVPGSET--------SNSKLIVAGLEGPSFDRRHSATQRLDK 186

  Fly   192 QPKETCSEI-----YGWNMTF-EQICAGNT----LSQLCSTD-SGAPQIRKMWHNGSDRYVQLGI 245
            :.|.|.::|     :.....| |::..|:|    ||....|: ||.|   :.:|     .:.:.:
  Fly   187 RIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTP---RQFH-----LLGIAV 243

  Fly   246 ASRVKGQCQNSGILMDLLSYADWIKR 271
            |........:.|.| ::..:.|||.:
  Fly   244 AGFFSSDLDHQGYL-NIRPHLDWISK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/260 (20%)
Tryp_SPc 48..269 CDD:214473 51/256 (20%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 32/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.