DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and sphinx1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:281 Identity:45/281 - (16%)
Similarity:94/281 - (33%) Gaps:87/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNISERSVNAKLAQNPWMAYL--------ETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT- 85
            |..:.:|.|......|:...:.||        :|....:.:||:|::.::||....:....:.. 
  Fly    17 GEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVH 81

  Fly    86 ------------VRLGEYNTKTKVDCDN--HLCQEPFQEYNVDMG-FRHRYYNANDQTNDIGMLR 135
                        :|:.:.|.:...|.|:  .|.:.|:|:::..|. .|...|:.           
  Fly    82 LASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDT----------- 135

  Fly   136 LGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEI 200
              |...|:.::..:|.:.:.:....:.:        |           :|.:.::......|::.
  Fly   136 --RFERYVGNMTMVCGYGTEKRHAKLPE--------W-----------MRCIEVEVMNNTECAKY 179

  Fly   201 YGWNMTFEQICAGNTLSQLCSTDSGAPQIRK---------MW---HNGSDRY--VQLGIASRVKG 251
            |.....:|...:|.....:|..|.|...:..         :|   .|.|..|  |.:.::..:| 
  Fly   180 YTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIK- 243

  Fly   252 QCQNSGILMDLLSYADWIKRV 272
                            |||||
  Fly   244 ----------------WIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 39/261 (15%)
Tryp_SPc 48..269 CDD:214473 36/258 (14%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 38/268 (14%)
Tryp_SPc 26..248 CDD:304450 40/270 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.