DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss9

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:282 Identity:60/282 - (21%)
Similarity:109/282 - (38%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCGIPHNISERS-----VNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITV 86
            ::||....:.:.:     ::|...:.||.|.|:......|..|::...::|:||||.        
  Rat   526 QECGARPAMDKPTRIVGGISAVSGEVPWQASLKEGSRHFCGATVVGDRWLLSAAHCF-------- 582

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQEY------------NVDMGFR----HRYYNANDQTNDIGMLR 135
                          ||...|..|.:            .|.:|.|    |..||......|:.:|.
  Rat   583 --------------NHTKLEQVQAHLGTVSLLGVGGSPVKLGLRSVALHPRYNPGILDFDVALLE 633

  Fly   136 LGRRVEYLNHIRPICI-FASNRFQEPIDQLTWFTTTVW-RETAANATS-KVLRTMNIDRQPKETC 197
            |.:.:.:..:|:|:|: .|.::|  |:.:....:.  | .....|||. .:|:..::....::.|
  Rat   634 LAQPLVFNKYIQPVCLPLAIHKF--PVGRKCMISG--WGNMQEGNATKPDILQKASVGIIEQKMC 694

  Fly   198 SEIYGWNMTFEQICAGNTLSQL--CSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG--QCQNSGI 258
            ..:|.:::|...:|||....::  |..|||.|   .........:...||.|...|  |.:..|:
  Rat   695 GALYNFSLTDRMLCAGFLEGRVDSCQGDSGGP---LACEETPGVFYLAGIVSWGIGCAQAKKPGV 756

  Fly   259 LMDLLSYADWIKRVVRQYGPST 280
            ...:....|||.:.:.....||
  Rat   757 YARITRLKDWILKAMSSDPSST 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/246 (22%)
Tryp_SPc 48..269 CDD:214473 53/243 (22%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.