DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss32

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:289 Identity:81/289 - (28%)
Similarity:130/289 - (44%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEDCGIPHNISERSV---NAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLI- 84
            |:..||.| ..|.|.|   ||:|.|.||...:. ..|.| |.|:||:..:|||||||...|..: 
  Rat    41 LDSVCGRP-RASGRIVSGQNAQLGQWPWQVSVR-EDGVHVCGGSLISEDWVLTAAHCFNQDQHLS 103

  Fly    85 --TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTN-DIGMLRLGRRVEYLNHI 146
              ||.||..::..:   ||    ||.:...|....::..|:|.:.:: ||.:|:|...:.:.:::
  Rat   104 AYTVLLGTISSYPE---DN----EPRELRAVAQYIKYPSYSAEEHSSGDIALLQLASPISFNDYM 161

  Fly   147 RPICIFASNRFQEPIDQLTWFTTTVWRETAANA------TSKVLRTMNIDRQPKETCSEIYGWNM 205
            .|:|:   .:..:|:|..|....|.|...|.|.      |.:.|:...||   .:||:..|..|.
  Rat   162 LPVCL---PKPGDPLDPGTMCWVTGWGNIATNQPLPPPFTLQELQVPLID---AKTCNTYYQENS 220

  Fly   206 --TFEQI------CAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS---G 257
              :.||:      |||  ......|:.|||.|.:..:    :|.::|.|:.| ....|..|   |
  Rat   221 VPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDV----NDVWIQAGVVS-WGSDCALSNRPG 280

  Fly   258 ILMDLLSYADWIKRVV-------RQYGPS 279
            :..::..|..||:..:       :.:.||
  Rat   281 VYTNVSVYISWIQNTMWNIPTEGKNFSPS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/247 (28%)
Tryp_SPc 48..269 CDD:214473 66/244 (27%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 72/257 (28%)
Tryp_SPc 54..295 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.