DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss42

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:268 Identity:67/268 - (25%)
Similarity:106/268 - (39%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGE--- 90
            ||.|.......|:|:..:.||...|.......|.|:|:|..:|||||||:...:...|::|:   
  Rat    77 CGQPLMKIMGGVDAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVKMGDRSV 141

  Fly    91 --YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153
              .||...:...|......|....|             ..|||.:|:|.:.|.:.:.|.|||: .
  Rat   142 YRQNTSLVIPIQNIFVHPKFSTTTV-------------VQNDIALLKLQQPVNFTSSIHPICV-P 192

  Fly   154 SNRFQEPIDQLTWFTTTVWRET---AANATSKVLRTMNIDRQPKETCSEIYGWNMTFE------- 208
            :..|........|  .|.|.:.   |....:::|:.::......|.|:|:.....:..       
  Rat   193 TGTFHVKAGTKCW--VTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRG 255

  Fly   209 QICA---GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYAD 267
            .:||   |.  ...|..|||.|...:.    .:|:||:|:.|...| |   .:.|:..|:..|..
  Rat   256 MVCAYKEGG--KDACQGDSGGPLSCEF----DNRWVQIGVVSWGIG-CGRKGHPGVYTDVAFYNK 313

  Fly   268 WIKRVVRQ 275
            |:..||.|
  Rat   314 WLITVVNQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/244 (24%)
Tryp_SPc 48..269 CDD:214473 58/241 (24%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 60/253 (24%)
Tryp_SPc 84..315 CDD:238113 60/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.