DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Gzmm

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:257 Identity:60/257 - (23%)
Similarity:110/257 - (42%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDL-LITVRLGEYNTK 94
            :||:            .|:|..|:..|...|.|.|::..:|||||||:.:.| .:.:..|.::. 
  Rat    34 VPHS------------RPYMVSLQNTKSHVCGGVLVHQKWVLTAAHCLSEPLQQLKLVFGLHSL- 85

  Fly    95 TKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE 159
                   |..|:|...:.:....:|..||...: ||:.:|:|..||:...:::|:.:....| .:
  Rat    86 -------HDPQDPGLTFYIKQAIKHPGYNLKYE-NDLALLKLDGRVKPSKNVKPLALPRKPR-DK 141

  Fly   160 PIDQLTWFTTTVWRET-AANATSKVLRTMNIDRQPKETCSEIYGWN--MTFEQIC--AGNTLSQL 219
            |.:. :..:|..|..| .....:|.|:.:::.......|:....||  :|...:|  ||......
  Rat   142 PAEG-SRCSTAGWGITHQRGQLAKSLQELDLRLLDTRMCNNSRFWNGVLTDSMLCLKAGAKGQAP 205

  Fly   220 CSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN---SGILMDLLSYADWIKRVVRQYGP 278
            |..|||.|.:     .|..:..  ||.|.....|.:   ..:...:..|:.||::|:.::.|
  Rat   206 CKGDSGGPLV-----CGKGKVD--GILSFSSKNCTDIFKPTVATAVAPYSSWIRKVIGRWSP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/232 (24%)
Tryp_SPc 48..269 CDD:214473 54/229 (24%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 58/249 (23%)
Trypsin 27..251 CDD:278516 56/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.