DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and F2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_075213.2 Gene:F2 / 29251 RGDID:61996 Length:617 Species:Rattus norvegicus


Alignment Length:320 Identity:77/320 - (24%)
Similarity:130/320 - (40%) Gaps:88/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSVNAKLAQN---------------------PW--MAYLETPKGFHCSGTLIN 67
            |.|||:.....::|:..|..:.                     ||  |.:.::|:...|..:||:
  Rat   329 EADCGLRPLFEKKSLTDKTEKELLDSYIDGRIVEGWDAEKGIAPWQVMLFRKSPQELLCGASLIS 393

  Fly    68 HLFVLTAAHCV----------PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNV------DMG 116
            ..:|||||||:          .:|||  ||:|:: ::|:            .|.||      :..
  Rat   394 DRWVLTAAHCILYPPWDKNFTENDLL--VRIGKH-SRTR------------YERNVEKISMLEKI 443

  Fly   117 FRHRYYNANDQTN-DIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVW---RETAA 177
            :.|..||..:..: ||.:|:|.:.|.:.::|.|:|:.........:........|.|   |||..
  Rat   444 YIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLQAGYKGRVTGWGNLRETWT 508

  Fly   178 NATSK----VLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLS-----QLCSTDSGAPQIRKMW 233
            ...::    ||:.:|:....:..|.......:|....|||..::     ..|..|||.|.:.|..
  Rat   509 TNINEIQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSP 573

  Fly   234 HNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRSLKKWVDKI 293
            :|  .|:.|:||.|..:| |..:|                 :||..|.:.| ||:|:.|:
  Rat   574 YN--HRWYQMGIVSWGEG-CDRNG-----------------KYGFYTHVFR-LKRWMQKV 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/254 (25%)
Tryp_SPc 48..269 CDD:214473 63/251 (25%)
F2NP_075213.2 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
Kringle 215..292 CDD:278480
Thrombin_light 312..359 CDD:286482 6/29 (21%)
Tryp_SPc 359..608 CDD:214473 69/284 (24%)
Tryp_SPc 360..612 CDD:238113 70/287 (24%)
High affinity receptor-binding region which is also known as the TP508 peptide 547..569 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.