DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Gzmk

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:252 Identity:65/252 - (25%)
Similarity:108/252 - (42%) Gaps:49/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT 95
            ||:            .|:||.::. :|.| |.|.||:..:|||||||.......||.||.::.. 
  Rat    34 PHS------------RPFMASIQY-RGKHICGGVLIHPQWVLTAAHCYSRGHSPTVVLGAHSLS- 84

  Fly    96 KVDCDNHLCQEPFQ--EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQ 158
                .|...::.|:  |:....||:       ..||||.:::|....|...|::.:.:.:.|..:
  Rat    85 ----KNEPMKQTFEIKEFIPFSGFK-------SGTNDIMLIKLRTAAELNKHVQLLHLRSKNYIR 138

  Fly   159 EPIDQLTWFTTTVWRETAAN--ATSKVLRTMNIDRQPKETCSEIYGWN----MTFEQICAGNTLS 217
            :.    |....|.|..|..:  .||..|:.:.:....::.|:....:|    :|.:.||||:...
  Rat   139 DG----TKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGDRRG 199

  Fly   218 Q--LCSTDSGAPQIRK-MWHNGSDRYVQLGIASRVKGQCQNSGILMDLL-SYADWIK 270
            :  .|..|||.|.|.| ::|.......:.||:::       .|:...|. .|..|||
  Rat   200 EKDSCKGDSGGPLICKGVFHALVSGGYKCGISNK-------PGVYTLLTKKYQTWIK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/236 (27%)
Tryp_SPc 48..269 CDD:214473 60/233 (26%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 62/249 (25%)
Tryp_SPc 26..251 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.