DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and f7i

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_775335.1 Gene:f7i / 282671 ZFINID:ZDB-GENE-021206-10 Length:443 Species:Danio rerio


Alignment Length:287 Identity:68/287 - (23%)
Similarity:105/287 - (36%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG-IPHNISERSVNAKLAQNPWMAYLETPKGFH--------------CSGTLINHLFVLTAAHCV 78
            || ||       |....:||.::..:..|:| |              |.|.|:...:::||||||
Zfish   172 CGKIP-------VQKNTSQNQFLGGIHCPRG-HCPWQVLIDYNGESVCGGALLEGPWLITAAHCV 228

  Fly    79 --PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVE 141
              .|...:....||::...   .|.  .:||   |.|...|.|..|:.....:|:.:|||...|:
Zfish   229 HQKDTRFLKAVTGEHDLDV---LDG--SEEP---YEVSAVFIHPNYDPETLDSDLALLRLRVPVQ 285

  Fly   142 YLNHIRPICIFASNRFQEPIDQLT--------------WFTTT----VWRETAANA-TSKVLRTM 187
            ...:..|||:        |..||.              |.|.|    :.||..... .|..|:.:
Zfish   286 RSLYAVPICL--------PTPQLARSELWAARFHTLSGWGTRTAGHNLRREKGLKGPASGTLQRL 342

  Fly   188 NIDRQPKETCSEIYGWNMTFEQICAGNTLSQ--LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVK 250
            .:...|...|...   |.|....|||.|...  .|....|:|.:.:.   |...:: .|:.|..:
Zfish   343 AVPLLPAAQCGNA---NTTANMFCAGYTEGDHASCRGHDGSPLVTRY---GETSFL-TGVVSWGR 400

  Fly   251 GQCQNSG---ILMDLLSYADWIKRVVR 274
            | |...|   |...:.::..|:..|::
Zfish   401 G-CGPPGYYWIYTKVENFLIWMDTVMK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/263 (23%)
Tryp_SPc 48..269 CDD:214473 59/260 (23%)
f7iNP_775335.1 GLA 20..82 CDD:214503
EGF_CA <91..120 CDD:238011
FXa_inhibition 129..164 CDD:291342
Tryp_SPc 188..420 CDD:214473 59/256 (23%)
Tryp_SPc 188..420 CDD:238113 59/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.