DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and f10

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:260 Identity:66/260 - (25%)
Similarity:108/260 - (41%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYL--ETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQ- 109
            ||.|.|  |...|| |.||::...|:|:||||:.:.|.|.|.:|||:|         |..|..: 
Zfish   257 PWQALLINENNMGF-CGGTILTEHFILSAAHCMNESLSIRVVVGEYDT---------LVPEGREA 311

  Fly   110 EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI----FASNRFQEPIDQLTWFTTT 170
            .::||....|:.|..:...|||.:::|.:.:::..:|.|.|:    ||.....:..|.|   .:.
Zfish   312 THDVDEILIHKNYQPDTYHNDIALIKLSKPIKFTKYIIPACLPEMKFAERVLMQQDDGL---VSG 373

  Fly   171 VWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ--LCSTDSGAPQIRKM- 232
            ..|......:|.:|:.:.:....:..|.|...:.::....|||....:  .|..|||.|.:.:. 
Zfish   374 FGRVREGGLSSTILQKLTVPYVNRAKCIESSNFKISGRMFCAGYDQEEKDACQGDSGGPHVTRFK 438

  Fly   233 ----------WHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRSLK 287
                      |..|..|..:.|:.::|.             .|..||...:.:..|.|  ..|||
Zfish   439 NTWFITGVVSWGEGCARKGKYGVYTQVS-------------KYIMWINNAMTKVMPET--GASLK 488

  Fly   288  287
            Zfish   489  488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/243 (25%)
Tryp_SPc 48..269 CDD:214473 59/240 (25%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 59/240 (25%)
Tryp_SPc 245..474 CDD:238113 61/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.