DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG18420

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:305 Identity:115/305 - (37%)
Similarity:162/305 - (53%) Gaps:25/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIGIAVICCLWR--RVQGFQMLLEEDCGI--PHNISERSVNAKLA---QNPWMAYLETPKG 58
            |...:||:|.|..|..  .:.|....|:.:||.  |..:..|.||.|:|   .:||||:|.|...
  Fly     1 MEIVVIGMASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSN 65

  Fly    59 -FHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYY 122
             |.|.||||:...|||||||...:..|.|||||||.|.|         ...:|:.|:..|:||:|
  Fly    66 QFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLK---------GYREEHQVNRTFQHRFY 121

  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTM 187
            :.|...|||.:|||...|.|..:||||||.....::..||.:...|.|.|..|.:...|..|||:
  Fly   122 DPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTL 186

  Fly   188 NIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ 252
            :|.|||.:.|:  :| ::...|.||||..|.||..|:|.|....:.:..:.|:||:|||...| :
  Fly   187 DISRQPSKMCA--FG-SVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNK-R 247

  Fly   253 CQNSGILMDLLSYADWIKRV-VRQYGPSTDMNRSLKKWVDKIPVF 296
            ||...:..|::|:.::|:|: :.|.|  .|.|:...| .||.|.|
  Fly   248 CQRPSVFTDVMSHIEFIRRIFLTQNG--NDRNQPTPK-PDKEPEF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 89/224 (40%)
Tryp_SPc 48..269 CDD:214473 88/221 (40%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 93/234 (40%)
Tryp_SPc 43..267 CDD:238113 93/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463328
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.