DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG18636

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:288 Identity:106/288 - (36%)
Similarity:155/288 - (53%) Gaps:13/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIG----IAVICCLWRRVQGFQMLLEEDCGI--PHNISERSVN---AKLAQNPWMAYL-ET 55
            |...:||    :.:|........|....|:..|||  ....:.|.:|   ||...:|||.:| .|
  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65

  Fly    56 PKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPF-QEYNVDMGFRH 119
            ...|.|.|:||....|||||||...:..:..|||||......:|..:.|.  | :|:.||.||:|
  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCN--FREEHMVDAGFKH 128

  Fly   120 RYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVL 184
            :.|:.|...|||.:|||.:.|.|.::|||||:...:|::..:|::...|.|.|.:|...:.|..|
  Fly   129 KLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDAL 193

  Fly   185 RTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249
            :|::|.|||.:.|::..|..:...|.||||..|.||:.|||.|....:.|..:.|:||:||||..
  Fly   194 QTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYT 258

  Fly   250 KGQCQNSGILMDLLSYADWIKRVVRQYG 277
            ...||.:.:..|:||:|::|.||.|.||
  Fly   259 NRNCQKASVFTDVLSHAEFILRVWRMYG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 88/225 (39%)
Tryp_SPc 48..269 CDD:214473 87/222 (39%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 91/235 (39%)
Tryp_SPc 45..278 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463323
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.