DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG33459

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:258 Identity:95/258 - (36%)
Similarity:137/258 - (53%) Gaps:9/258 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GFQMLLEEDCG-IPHNIS-ERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV-PDD 81
            |..:|||.:|| ||..:. ...::|.|...||||:|.....|.|.|:||...||||||||| |..
  Fly    20 GLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTP 84

  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146
            ..:|||||||:...::|..|.  :...:||.|...:.|..|. :....||.:|:|.:.|||...|
  Fly    85 KNLTVRLGEYDWTRQMDSINP--KHRHREYMVTRIYTHPSYR-SIAAYDIALLKLNQTVEYTVAI 146

  Fly   147 RPICIFASNRFQE---PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE 208
            ||||:.....|.|   .:|.:..||.|.|..|.....|:||::.|:.:..:.||.:.||.::...
  Fly   147 RPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHT 211

  Fly   209 QICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKR 271
            .||||::.|..|..|||:|...|:.||....:.|:||.||....|....:..:::|:.:||.|
  Fly   212 HICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWIFR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 85/228 (37%)
Tryp_SPc 48..269 CDD:214473 82/224 (37%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 84/237 (35%)
Tryp_SPc 38..272 CDD:238113 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.