DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Sp212

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:112/249 - (44%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QNPWMAYLETPK----GFHCSGTLINHLFVLTAAHCV---PDDLLITVRLGEYNTKTKVDCDNHL 103
            |.||::.:...:    .|.|.|:||:...|::|||||   .:|.:: |.||.|      |.|:: 
  Fly   287 QYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVV-VGLGRY------DLDDY- 343

  Fly   104 CQEPFQEYNVDMGFRHRYYNANDQTN-DIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWF 167
            .::..:..||.....|..||....:: ||.::.:.|.|.:.:.|.|||::.       ::.....
  Fly   344 GEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWT-------VEASRTV 401

  Fly   168 TTT----VWRETAANATSKVLRTMNIDRQPKETCSEIY-GWNMTFEQICAGN-TLSQLCSTDSGA 226
            :||    .|.....::.::..|.:..:......|:..: |..:|...:|||| ..|..|..|||.
  Fly   402 STTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG 466

  Fly   227 PQIRKMWHNGSDRYVQLGIASRVK----GQCQ-NSGIL-MDLLSYADWIKRVVR 274
            ..:.|.    .||::..||.|..:    |.|| |..:| .||..:.:||...:|
  Fly   467 GLMVKQ----GDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 64/243 (26%)
Tryp_SPc 48..269 CDD:214473 62/240 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/245 (27%)
Tryp_SPc 277..511 CDD:214473 63/242 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.