DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and TPSG1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:279 Identity:73/279 - (26%)
Similarity:111/279 - (39%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISE---RSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT-- 85
            ||.| .:|:   |.|....|..   ||.|.|...:...|.|:|::..:|||||||....|..:  
Human    51 CGRP-QVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDY 114

  Fly    86 -VRLGE--------YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVE 141
             |.|||        ::|..::...:....:|                  ..:.||.::.|...|.
Human   115 QVHLGELEITLSPHFSTVRQIILHSSPSGQP------------------GTSGDIALVELSVPVT 161

  Fly   142 YLNHIRPICI-FASNRFQEPIDQLTWFTTTVW---RETAANATSKVLRTMNIDRQPKETCSEIY- 201
            ..:.|.|:|: .||:.|...|  ..|  .|.|   ||.........||.:.:.....|||...| 
Human   162 LSSRILPVCLPEASDDFCPGI--RCW--VTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYP 222

  Fly   202 ---GWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILM 260
               |..:..:.:||... ...|..|||.|.:.::  ||:  :||.|..|..:| |   ...|:..
Human   223 GPGGSILQPDMLCARGP-GDACQDDSGGPLVCQV--NGA--WVQAGTVSWGEG-CGRPNRPGVYT 281

  Fly   261 DLLSYADWIKRVVRQYGPS 279
            .:.:|.:||:|.:...|.|
Human   282 RVPAYVNWIRRHITASGGS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/245 (26%)
Tryp_SPc 48..269 CDD:214473 61/242 (25%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 64/255 (25%)
Tryp_SPc 63..293 CDD:238113 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.