DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and KLK5

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:259 Identity:63/259 - (24%)
Similarity:103/259 - (39%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SERSVNAK---LAQNPWM-AYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTK 96
            |.|.:|..   :...||. |.|..|...:|...|::..::||||||  ...:..||||.|:....
Human    64 SSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHC--RKKVFRVRLGHYSLSPV 126

  Fly    97 VDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI------------ 149
            .:..    |:.||...   ...|..|:....:||:.:::|.||:.....:|||            
Human   127 YESG----QQMFQGVK---SIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTK 184

  Fly   150 CIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGN 214
            |:.:.           |.||    ::......|||:.:||....::.|.:.|...:.....|||:
Human   185 CLVSG-----------WGTT----KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGD 234

  Fly   215 TLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYADWIKRVVR 274
            ...: .|..|||.|.:    .|||.:    |:.|.....|   ...|:..:|..:..||:..::
Human   235 KAGRDSCQGDSGGPVV----CNGSLQ----GLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/240 (25%)
Tryp_SPc 48..269 CDD:214473 58/237 (24%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 2/3 (67%)
Tryp_SPc 66..285 CDD:214473 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.