DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:249 Identity:61/249 - (24%)
Similarity:104/249 - (41%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTK 96
            :...|.||..:::.|         .|:| |.|:|||..:|::||||...  .|.|||||:|.   
  Rat    28 YTCQENSVPYQVSLN---------SGYHFCGGSLINDQWVVSAAHCYKS--RIQVRLGEHNI--- 78

  Fly    97 VDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPI 161
                 ::.:...|..|.....:|..::.....|||.:::|...|:....:..:.:.:|   ..|.
  Rat    79 -----NVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSS---CAPA 135

  Fly   162 DQLTWFTTTVWRETAANATSK--VLRTMNIDRQPKETCSEIYGWNMTFEQICAG--NTLSQLCST 222
            .  |....:.|..|.::..::  :|:.::....|:..|...|...:|...:|.|  ......|..
  Rat   136 G--TQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQG 198

  Fly   223 DSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYADWIKRVV 273
            |||.|.:    .||..:    ||.|...| |   .|.|:...:.:|.|||:..:
  Rat   199 DSGGPVV----CNGELQ----GIVSWGYG-CALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/231 (25%)
Tryp_SPc 48..269 CDD:214473 55/228 (24%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 59/243 (24%)
Tryp_SPc 24..242 CDD:238113 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.