DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30323

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:268 Identity:58/268 - (21%)
Similarity:99/268 - (36%) Gaps:90/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCV---PD----------DLLITV----RLGEYNTKT-----KVDCDNHL 103
            |:|:|::..:|:|:..||   |:          :|.:.|    ||.:.:.|.     |:..|...
  Fly    54 CAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDESA 118

  Fly   104 ---CQEPFQEYNVDMGFRHRYY---------NANDQTNDIGMLRLGRRVEYLN--HIRPICIFAS 154
               |.| .....:|.|...:.:         |:....|.:|.    .|:.|::  :|..:|...|
  Fly   119 ISGCTE-LALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGW----GRIYYVSYVYISAMCPAFS 178

  Fly   155 NRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNI-DRQPKETCSEIYGWNMTFEQIC------A 212
            ..:..|:   |||     ::...::....:|...| :.:.|..||..         :|      .
  Fly   179 MVYDNPV---TWF-----QDGPYSSELIQIRAQKISEYECKPDCSRC---------LCMTSYTGR 226

  Fly   213 GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILM------------DLLSY 265
            ||    :|..|.|:|..       .|.:: .|:|.||. .|.:.|.:.            |.||.
  Fly   227 GN----MCQQDLGSPLF-------CDHFL-YGVARRVH-TCDDEGFMFYTNIYQNRKFIEDTLSG 278

  Fly   266 ADWIKRVV 273
            |.|.|||:
  Fly   279 ATWPKRVL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/265 (21%)
Tryp_SPc 48..269 CDD:214473 54/262 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 50/255 (20%)
Tryp_SPc 45..272 CDD:214473 50/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.