DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30288

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:280 Identity:89/280 - (31%)
Similarity:135/280 - (48%) Gaps:21/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAVICCLW----RRVQGFQMLLEEDCGIPHNISERS-----VNAKLAQNPWMAYLETPKGFHCSG 63
            :.::.||:    |...|  .|||.|||...:...|:     .:|.:..||||..:.......|.|
  Fly     8 LVIVACLFIGIIRTESG--RLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGG 70

  Fly    64 TLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKV-DCDNHLCQEPFQEYNVDMGFRHRYYNANDQ 127
            :||...|||||.||: ..:.:.||||||:|:..: |||:.:|..  :.||||:..:..:.|..  
  Fly    71 SLITARFVLTAEHCI-SPMYMNVRLGEYDTRHPIFDCDDFVCTP--RAYNVDVDRKIVHSNPG-- 130

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRF-QEPIDQLTWFTTTVWRETAANATSKVLRTMNIDR 191
             .|||:||:.|.|.:.|::||||:...... ..|:..|. |..|.|...:.......|:|..:.:
  Fly   131 -YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILR-FNFTGWGTNSDGEEQDRLQTATLQQ 193

  Fly   192 QPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS 256
            .|:.:| |..|..:....||||:.:|..|..|||.|........|..|..|.|:||:....|...
  Fly   194 LPQWSC-ERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL 257

  Fly   257 GILMDLLSYADWIKRVVRQY 276
            ||..::..:.|||..|::.:
  Fly   258 GIYTNVTHFTDWILDVIQNH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/225 (33%)
Tryp_SPc 48..269 CDD:214473 73/222 (33%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 75/235 (32%)
Tryp_SPc 45..270 CDD:238113 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.