DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30286

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:247 Identity:88/247 - (35%)
Similarity:142/247 - (57%) Gaps:2/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEDCGI--PHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVR 87
            ||.|||.  |..:......|.::::||||||.......|.|||:||.|:||||||:.:|..:|||
  Fly    22 LEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVR 86

  Fly    88 LGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIF 152
            |||:|:.|.:||:...|..|.:::.:|:.|||..|:..::.:|||:|||.:.|||..||:|||:.
  Fly    87 LGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLI 151

  Fly   153 ASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLS 217
            .:...|..|::|.....|.|..:.:.|.:.:|:::.:.|.....||:.|..:...:|||..:...
  Fly   152 TNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESG 216

  Fly   218 QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWI 269
            ..||.|||.|..:.:..:|...:||:||.|....:|.:..:..:::.:.|||
  Fly   217 VSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 81/222 (36%)
Tryp_SPc 48..269 CDD:214473 79/220 (36%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 82/230 (36%)
Tryp_SPc 39..268 CDD:214473 80/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463326
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.