DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30187

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:122/260 - (46%) Gaps:16/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GFQMLLEEDCGIPHNISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD 81
            |..:.|::.|||  ||:.:..   ||....:.|||.:.....|.|.||||:..||||||||:.|.
  Fly    19 GASIFLDQICGI--NIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQ 81

  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146
            .:.:|.||.||.....|..:.:.......::|...:.          ||||:|:|...|.:...|
  Fly    82 DVQSVSLGAYNKSDPADRKDVITAVVHSSFDVRASYE----------NDIGLLKLSSDVIFNALI 136

  Fly   147 RPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQIC 211
            |||||..:......:..:..|....|.....|.||.:|:|:.::...:|.|........:.:|||
  Fly   137 RPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQIC 201

  Fly   212 AGNTLSQLCSTDSGAPQIRKMWHNG-SDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQ 275
            ||......|..|||.|....::..| .:|.||.||.|..|..|...|:..||:|:|||||..:.:
  Fly   202 AGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADWIKMTIER 266

  Fly   276  275
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/224 (33%)
Tryp_SPc 48..269 CDD:214473 72/221 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 74/234 (32%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.