DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30091

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:305 Identity:92/305 - (30%)
Similarity:144/305 - (47%) Gaps:30/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICCLWRRV--QGFQMLLEEDCGIPHNISER---SVNAKLAQNPWMAYLETPKGFHCSGTLINHL 69
            |:...|...  :|...||:||||:|..:..:   .|:|...:|||||.::|...|.|.|::|.:.
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNK 70

  Fly    70 FVLTAAHCVPDD-------LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQ 127
            ||||||||:..|       ..:||.||.|:.....: .||    |.:.|||:..:.|..:...:.
  Fly    71 FVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGE-HNH----PHEIYNVERVYIHDSFAIQNY 130

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQ 192
            .|||.:|||.:.:.|...|:|:||..:::.:...|.:..||...|..|.....|..|:.:.|.|.
  Fly   131 RNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRI 195

  Fly   193 PKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS 256
            .::.|...:.:...:...|||..:.: .|..|||.|....|..:|..|..||||.|.....|:..
  Fly   196 DRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGF 260

  Fly   257 GILMDLLSYADWIKRVVRQYG-----PSTDM-------NRSLKKW 289
            |:..|::.:.|:|:|:|....     |..|:       |.:|..|
  Fly   261 GMYTDVMGHIDFIERIVLDADIEVVLPYIDLLDAGCLGNDTLNSW 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 72/231 (31%)
Tryp_SPc 48..269 CDD:214473 71/228 (31%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 74/241 (31%)
Tryp_SPc 37..276 CDD:238113 75/243 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463319
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.