DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30087

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:277 Identity:95/277 - (34%)
Similarity:141/277 - (50%) Gaps:17/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIIGIAVICCLWR--RVQGFQMLLEEDCGIPH--NISERSVNAK---LAQNPWMAYLETPKGFHC 61
            |:|.|    ||.|  |:...| .|...||:.:  ..:.|.||.|   :...|:|.|:......||
  Fly     8 FVIAI----CLIRQQRIVDAQ-FLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHC 67

  Fly    62 SGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAND 126
            .|:::|..::|||||||..:|  .:||||:|.:|..||....|....:||.:.....||:|||.:
  Fly    68 GGSILNSRYILTAAHCVFPNL--RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAAN 130

  Fly   127 QTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDR 191
            ..|||.:|:|.|.:.:..||:||||.. |....|  .:..:.|..|.||..|....:|:|..:..
  Fly   131 HVNDIALLKLNRSINFNVHIQPICILL-NPASAP--SVATYQTFGWGETKKNGFPHLLQTAELRA 192

  Fly   192 QPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS 256
            .....||..:...|...|||||:.....|:.|||.|.:.::..:|..||:||||.|.....||:.
  Fly   193 YDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSP 257

  Fly   257 GILMDLLSYADWIKRVV 273
            |:...:.:|.:||:|.:
  Fly   258 GVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 79/223 (35%)
Tryp_SPc 48..269 CDD:214473 77/220 (35%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 81/233 (35%)
Tryp_SPc 42..272 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463327
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.