DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30083

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:283 Identity:99/283 - (34%)
Similarity:142/283 - (50%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIIGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSV---NAKLAQNPWMAYL-----ETPKGFH 60
            ||..|..|..||  .......||.:||.| :||.:.:   ||:...||||||:     :......
  Fly     2 FIFTIFKIILLW--PGAMSQFLEPNCGYP-DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV 63

  Fly    61 CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAN 125
            |.||||:..|||:||||:..|.::.|||||:::.              :.:.|...||::|:...
  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSS--------------RYFAVTKAFRNKYFTTG 114

  Fly   126 DQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEP--IDQLTWFTTTVWRETAANATSKVLRTMN 188
            ..:||||:||:...|::...||||||..     :|  :..:..|....|.:|.....||||:|:.
  Fly   115 SYSNDIGILRIQPIVKFNAVIRPICIIT-----DPTKVPNVKTFKAAGWGKTENETFSKVLKTVE 174

  Fly   189 IDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC 253
            ::......|..:...|:|..|||||:.....|:.|||.|.|..::.:||.|||||||.|.....|
  Fly   175 LNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC 239

  Fly   254 QNSGILMDLLSYADWIKRVVRQY 276
            .:.|:...|.|:.|||..||..|
  Fly   240 NSPGVYTRLSSFIDWILMVVDNY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 80/230 (35%)
Tryp_SPc 48..269 CDD:214473 78/227 (34%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 81/240 (34%)
Tryp_SPc 34..255 CDD:238113 81/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463325
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.