DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30002

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:291 Identity:87/291 - (29%)
Similarity:135/291 - (46%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FQMLLEEDCGIPHN----ISERSV-----NAKLAQNPWMAYLETPKGF---HCSGTLINHLFVLT 73
            ::.|.::|||:..|    :..|.:     .:.|...||||:|......   .|.|:||:.|||||
  Fly    38 YENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLT 102

  Fly    74 AAHC---VPDDLLITVRLGEYNTKTKVDCDNH----LCQEPFQEYNVDMGFRHRYYNANDQTNDI 131
            ||||   .|....|.|.|||.:..:..||..:    :|..|.:|:.:|....|..:|......||
  Fly   103 AAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDI 167

  Fly   132 GMLRLGRRVEYLNHIRPICIFASNRFQEPI-DQLTWFTTTV--------WRETA----ANATSKV 183
            .:::|.::|.:.:||||||:        |: |:|..||..:        |.:|.    ||:|.:|
  Fly   168 ALIKLNKKVVFKDHIRPICL--------PLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTMEV 224

  Fly   184 -LRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS 247
             :||        |.|::  |.:.:|  :||.......|:.|||.|.:.|....|.||.||.|:.|
  Fly   225 DIRT--------EKCTD--GRDTSF--LCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVS 277

  Fly   248 RVKGQC--QNSGILMDLLSYADWIKRVVRQY 276
            .....|  .:....||:.:|..||...:.::
  Fly   278 TGSQNCGAGHKAYYMDVPTYMPWILEKMAEF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 80/249 (32%)
Tryp_SPc 48..269 CDD:214473 78/246 (32%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 79/258 (31%)
Tryp_SPc 62..301 CDD:238113 79/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.