DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Klk1b3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:258 Identity:67/258 - (25%)
Similarity:109/258 - (42%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQ 105
            |.::...||...:.....:.|.|.||:..:|:|||||..|:  ..|.||.          |:|.:
  Rat    34 NCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHCATDN--YQVWLGR----------NNLYE 86

  Fly   106 -EPFQE------------YNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRF 157
             |||.:            :|.|:.:.|.....:|.:||:.:|.|.:..:..:.::.|.:      
  Rat    87 DEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDL------ 145

  Fly   158 QEPIDQLTWFTTTV---WRETAANA--TSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAG--NT 215
              ||::....:|.:   |.....:.  .|..|:.:|||....|.|.|.:...:|...:|||  :.
  Rat   146 --PIEEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDG 208

  Fly   216 LSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS---RVKGQCQNSGILMDLLSYADWIKRVVRQ 275
            ....|..|||.|.|    .||    |..||.|   ...|:.:..||...|:.:..|||.|:::
  Rat   209 GKDTCKGDSGGPLI----CNG----VLQGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/246 (26%)
Tryp_SPc 48..269 CDD:214473 62/243 (26%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 63/250 (25%)
Tryp_SPc 29..260 CDD:238113 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.