DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Ovch2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:313 Identity:69/313 - (22%)
Similarity:117/313 - (37%) Gaps:65/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGIAVICCLWRRVQGFQMLLEEDCG------IPHN---ISERSVNAKLAQN---PWMAYLETPK 57
            |:.:.::|......:....:...|||      .|.|   :..|.|.....:.   ||...|:..:
Mouse     9 ILILGMVCLEQGHSETLSSIRNPDCGQSLVKPQPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQKQ 73

  Fly    58 GFHCSGTLINHLFVLTAAHCVPD---DLLITVRLGEYNTKTKVDCDNHLCQ-EP-FQEYNVDMGF 117
            ...|.||:|:..:|:|||||:.:   .|.:.|..||::          |.| || .|...::...
Mouse    74 KHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHD----------LSQAEPGEQTLAIETII 128

  Fly   118 RH-RYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT---WFTTTVW-RETAA 177
            .| ::........||.:|::....::...:||:|:      .||.:...   ..||..| |.:..
Mouse   129 IHPQFSTRKPMIYDIALLKMAGTFQFGQFVRPVCL------PEPGEHFNAGFICTTAGWGRLSEG 187

  Fly   178 NATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL---------SQLCSTDSGAP---QIR 230
            ....:||:.:|:....:|.|..:.   :|.:....|.|.         ...|..|||..   |.|
Mouse   188 GRLPQVLQQVNLPILTQEECEAVL---LTLKNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNR 249

  Fly   231 K---------MWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVR 274
            |         .|..|..|..:.....:.:|   :.||..||.....||.:.::
Mouse   250 KGAWTLAGVTSWGLGCGRSWRNNARKKEQG---SPGIFTDLRRVLPWILKHIQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/254 (24%)
Tryp_SPc 48..269 CDD:214473 58/251 (23%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 60/264 (23%)
Tryp_SPc 52..297 CDD:238113 61/266 (23%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.