DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:277 Identity:74/277 - (26%)
Similarity:114/277 - (41%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEEDCGI---PHNI-------SERSV----NAKLAQNPWMAYLE-TPKGFHCSGTLINHLFVLT 73
            ||...|||   ..||       :||.|    .|...:.||.|.|: ...|..|..|||::.::||
Mouse   182 LLNSRCGIRMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLT 246

  Fly    74 AAHCV-----PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGM 133
            ||||.     |...::|     :.|         ....|..:.:|.....|..|:.:...|||.:
Mouse   247 AAHCFWKNRDPTKWIVT-----FGT---------TITPPLVKRSVGKIIIHEEYHRDTNENDIAL 297

  Fly   134 LRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCS 198
            .:|..|||:.|.::.:|:..|:....|  :.:.|.|..........|...||...::....:.|:
Mouse   298 AQLTTRVEFSNVVQRVCLPDSSMKLPP--KTSVFVTGFGSIVDDGPTQNKLRQARVETIGSDVCN 360

  Fly   199 --EIYGWNMTFEQICAGNTLSQL--CSTDSGAPQI---RKMWHNGSDRYVQLGIASRVKGQ-C-- 253
              ::|...:|...:|||....::  |..|||.|.:   |.:|      |: :||.|  .|| |  
Mouse   361 RKDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNRDIW------YI-VGIVS--WGQSCAL 416

  Fly   254 -QNSGILMDLLSYADWI 269
             ...|:...:..|.|||
Mouse   417 PNKPGVYTRVTKYRDWI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/239 (26%)
Tryp_SPc 48..269 CDD:214473 61/237 (26%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113
Tryp_SPc 207..436 CDD:238113 65/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.