DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:260 Identity:66/260 - (25%)
Similarity:100/260 - (38%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEY 91
            :..:|:.:   |:||               |:| |.|:|||..:|::||||.  ...|.|||||:
Mouse    32 ESSVPYQV---SLNA---------------GYHFCGGSLINDQWVVSAAHCY--KYRIQVRLGEH 76

  Fly    92 NTKTKVDCDNHLCQEPFQEYNVDMG--FRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI----- 149
            |......          .|..||..  .||..||:....|||.:::|...|.....:..:     
Mouse    77 NINVLEG----------NEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSS 131

  Fly   150 CIFASNRFQEPIDQLTWFTTTVWRETAANATSK--VLRTMNIDRQPKETCSEIYGWNMTFEQICA 212
            |..|.          |....:.|..|.:|..:.  :|:.::....|:..|...|..::|...||.
Mouse   132 CAPAG----------TQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDITNNMICV 186

  Fly   213 G--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWIKRVV 273
            |  ......|..|||.|.:    .||..:    ||.|...|..|..  |:...:.:|.|||:..:
Mouse   187 GFLEGGKDSCQGDSGGPVV----CNGELQ----GIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTI 243

  Fly   274  273
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/237 (26%)
Tryp_SPc 48..269 CDD:214473 60/234 (26%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 64/254 (25%)
Tryp_SPc 24..242 CDD:238113 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.