DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss4

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:267 Identity:65/267 - (24%)
Similarity:102/267 - (38%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCG----IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT--- 85
            |||    .|..:.  .|.|.:...||...::..|...|.|::::..::||||||....|.::   
Mouse   193 DCGKSLKTPRVVG--GVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWK 255

  Fly    86 VRLGE--YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRP 148
            ||.|.  ......:........||...|              .:..||.:::|...:.:...:||
Mouse   256 VRAGSNILGNSPSLPVAKIFIAEPNPLY--------------PKEKDIALVKLQMPLTFSGSVRP 306

  Fly   149 ICIFASNRFQEPIDQLTWFTTTVW------RETAANATSKVLRTMNIDRQPKETCS--EIYGWNM 205
            ||:..|:....|       .|.||      .|......|.:|...::.......|:  :.|...:
Mouse   307 ICLPFSDEVLVP-------ATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEV 364

  Fly   206 TFEQICAGNTL--SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSY 265
            |.|.:|||...  ...|..|||.|   .|:|  ||::..:||.|...| |   ...|:...:.:|
Mouse   365 TAEMLCAGTPQGGKDTCQGDSGGP---LMYH--SDKWQVVGIVSWGHG-CGGPSTPGVYTKVTAY 423

  Fly   266 ADWIKRV 272
            .:||..|
Mouse   424 LNWIYNV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/241 (24%)
Tryp_SPc 48..269 CDD:214473 56/238 (24%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 1/1 (100%)
Tryp_SPc 202..427 CDD:214473 58/253 (23%)
Tryp_SPc 203..430 CDD:238113 60/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.