DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and T22A3.6

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:163 Identity:30/163 - (18%)
Similarity:49/163 - (30%) Gaps:55/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDI-------GMLRLGRRVEYLNHIRPI 149
            |.....||      |..:|.....|:|..:|  :|.|.::       |.:|:.....:....|.:
 Worm    33 NVSISDDC------ETTEESERIFGYRTNFY--SDDTGNVFCFRKKDGSIRMSSTSRFFEDPRFM 89

  Fly   150 CIFASNRFQEPIDQLTWF-----------TTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGW 203
            |...|         :.|:           ....| .:..|:|..:          .::.|..|..
 Worm    90 CSKGS---------MDWYRGKKNVDFKDRPCLFW-SSIPNSTFDI----------SDSSSSSYSM 134

  Fly   204 NM----TFEQICAG---NTLSQLC--STDSGAP 227
            |.    .:|..|..   |.|...|  ..|:.||
 Worm   135 NRILPDEYENFCRNPDKNPLGPWCYVGNDTTAP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 30/163 (18%)
Tryp_SPc 48..269 CDD:214473 30/163 (18%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 14/81 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.