DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and try-5

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:294 Identity:60/294 - (20%)
Similarity:103/294 - (35%) Gaps:86/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYL--ETPKG-FH--CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNH----- 102
            ||...:  :..|| |.  |.||||....|||||||...........||.|:.:...|:::     
 Worm    55 PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTD 119

  Fly   103 -------------LCQEPFQEY------------NVDMGFRHRYYNAN-DQTNDIGMLRLGRRVE 141
                         :|....|:|            .:.......:|..: :|.|||.:|.|...::
 Worm   120 SEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTID 184

  Fly   142 YLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATS----------------KVLRTMNID 190
            .:......|:        |      |...|..::.||.||                .:::.:.:.
 Worm   185 DVEGANYACL--------P------FLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLA 235

  Fly   191 RQPKETCSEIYGWNMTFEQIC-AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQ 254
            .:...||.|.:|.::.|:..| |......:||.|||.    .:..:.||...:..||        
 Worm   236 TETLATCEENWGTSIPFDSFCTAEEEDKNVCSGDSGG----GLTFHQSDSAREFIIA-------- 288

  Fly   255 NSGILMDLLSYADWIKRVVRQYGPSTDMNRSLKK 288
                   ::||.....:::....|.:.:|..::|
 Worm   289 -------IVSYGSDCVQLIGGSEPRSQINTDVRK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/276 (21%)
Tryp_SPc 48..269 CDD:214473 57/273 (21%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 57/273 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.