DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and try-4

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:272 Identity:50/272 - (18%)
Similarity:86/272 - (31%) Gaps:94/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VQGFQMLLE-----EDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC 77
            ::.||.:::     |.|||..       .:|:...||.............|::|:...::||||.
 Worm    31 MESFQTIVDNEVLMESCGIQQ-------ESKIKNFPWAVSFTVDGVNRLGGSIISPYHIITAAHG 88

  Fly    78 VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGF---------------RHRYYNAND- 126
                 .||......|.     |:|...::|.......:.|               .|.....|| 
 Worm    89 -----FITTIGSRGNL-----CENKNWKKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDP 143

  Fly   127 ---------------------------QTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL 164
                                       :.:|..::.:.:|:.:..::||||:...|.:       
 Worm   144 RCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLPRPNMY------- 201

  Fly   165 TWFTTTV----W-RETAANATSKVLR--TMNIDRQPKETCSE---------IYGWNMTFEQICAG 213
              :|.::    | |....|.:..::.  .|.|||..|...|:         |...:|......|.
 Worm   202 --YTKSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRLPADADDFICATSMNVSNYSAP 264

  Fly   214 NTLSQLCSTDSG 225
            .|    |..|||
 Worm   265 RT----CHGDSG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 43/237 (18%)
Tryp_SPc 48..269 CDD:214473 43/237 (18%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 44/252 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.