DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and try-3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:273 Identity:62/273 - (22%)
Similarity:119/273 - (43%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WMA----YLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQ 109
            |||    |.:..:|..|..|:|:..:::|||||.   |.:..|...|..:.|.:.:        :
 Worm    50 WMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCA---LQLQTRSFVYVREPKNNRE--------R 103

  Fly   110 EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASN-----RFQEPIDQLTWFTT 169
            .::|...:.|..||.....|||.:||:...:..|. |:|:|:...:     :::..:  :..:..
 Worm   104 SFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLG-IKPVCLVHDDSKLLKQYKNGV--VIGYGL 165

  Fly   170 TVWRETAAN---ATSKVLRTMNIDRQPKETCSEIYGW------NMTFEQICAGNTLSQLCSTDSG 225
            |:..:::..   ..|:.|::.::.....:.|.:.:.:      .:|..|||||..|......|||
 Worm   166 TLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSG 230

  Fly   226 APQIRKMWHNGSDRYVQLGIAS-------RVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMN 283
            .|   .:.|..:..|||:||.|       .|..|.:..|:...:..|..||:.|:.:....:.:.
 Worm   231 GP---LLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIGKTSMRSSVT 292

  Fly   284 RSLKKWVDKIPVF 296
            .|...:.:.:|:|
 Worm   293 SSSPIYFNFLPIF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/247 (23%)
Tryp_SPc 48..269 CDD:214473 56/244 (23%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.