DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and try-10

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:257 Identity:60/257 - (23%)
Similarity:107/257 - (41%) Gaps:51/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCV--PDDLLIT--VRLGEYNTKTKVDCDNHLCQEPFQEYNVD-MGFRHR 120
            |.|.||....|:|:||||  .||..:|  |.||:.:.....|.:        ||:... |....:
 Worm   104 CGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGE--------QEFRSHAMAISKK 160

  Fly   121 YYN-ANDQTNDIGMLRLGRRVEYLN-----HIRPICIFASNRFQE--PIDQLTWFTTTV----WR 173
            ::| |::..:|:.::.|.:|.:..:     .|..:....|..|:|  |:.||...|:..    |.
 Worm   161 FFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGWG 225

  Fly   174 ETAANATSKV---LRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHN 235
            :| .|.|:|.   :|.|.::...:......|    ...:...|:  |:.|..|||:|..  .:.|
 Worm   226 KT-ENKTAKYSDSVRQMMVNLSVRRIGKRKY----LIAKAVTGS--SRACMGDSGSPVY--CFVN 281

  Fly   236 GSDRYV----QLGIASRVKGQCQNSGIL----MDLLSYADW------IKRVVRQYGPSTDMN 283
            |....|    .:|..|::..|..::.|.    .:....:||      :..::::||....:|
 Worm   282 GKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDWRESSERVVEILQKYGELYQLN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/244 (23%)
Tryp_SPc 48..269 CDD:214473 57/241 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 51/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.