DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:292 Identity:65/292 - (22%)
Similarity:113/292 - (38%) Gaps:64/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLWRRVQGFQMLLEEDCGIPHNISERSV----------NAKLAQNPWMAYLETPKGFH-CSGTLI 66
            |..|.|...:.:   :||:      |||          .|.....||...|.. :|.| |.|::|
  Rat   230 CSSRMVVSLRCI---ECGV------RSVRRQSRIVGGSTASPGDWPWQVSLHV-QGIHVCGGSII 284

  Fly    67 NHLFVLTAAHCVPDDL-----------LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHR 120
            ...:::||||||.:.|           ::...|..|.::                :.|:....|.
  Rat   285 TPEWIVTAAHCVEEPLSSPRYWTAFAGILKQSLMFYGSR----------------HQVEKVISHP 333

  Fly   121 YYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-AANATSKVL 184
            .|::..:.|||.:::|...:.:.:.::|:|: .:......:.|..|.:.  |..| ....||.||
  Rat   334 NYDSKTKNNDIALMKLQTPLAFNDVVKPVCL-PNPGMMLDLAQECWISG--WGATYEKGKTSDVL 395

  Fly   185 RTMNIDRQPKETCSEIYGWN--MTFEQICAGNTLSQL--CSTDSGAPQI---RKMWHNGSDRYVQ 242
            ....:.......|:..|.:|  :|...||||.....:  |..|||.|.:   .::|....|....
  Rat   396 NAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNEIWWLIGDTSWG 460

  Fly   243 LGIASRVKGQCQNSGILMDLLSYADWIKRVVR 274
            .|.|     :....|:..::..:.|||.:.:|
  Rat   461 SGCA-----KAYRPGVYGNVTVFTDWIYQQMR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/243 (23%)
Tryp_SPc 48..269 CDD:214473 53/240 (22%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133 5/25 (20%)
Tryp_SPc 253..482 CDD:214473 54/253 (21%)
Tryp_SPc 254..485 CDD:238113 56/255 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.