DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG43742

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:300 Identity:98/300 - (32%)
Similarity:132/300 - (44%) Gaps:40/300 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRV---------QGFQMLLEEDCGIPHNISERSVNAKLA-QNPWMAYLETPKGFHCSGTL 65
            :|| |..:         ..|..||:|:|.:  .|:.|..|...| .:.:||.|.....|.|.|:|
  Fly     1 MCC-WFSLLLVAVVIYQNAFAQLLDENCKV--KITYRVANGHTAITSQFMAALYNNSEFFCGGSL 62

  Fly    66 INHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTND 130
            |:..:||||||||.|...:||.|||.|....:....|:.:     .|..: ..|..::.|...||
  Fly    63 IHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLR-----LNAKV-ILHPNFHGNIFLND 121

  Fly   131 IGMLRLGRRVEYLNHIRPICIF-----ASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNID 190
            |.:|||.|.|.:..|||||||.     .||....       ||...|.:|.....|.||..:::.
  Fly   122 IALLRLEREVIFEAHIRPICIILDEDVTSNNQNN-------FTAYGWGKTEHGNISDVLSFIDLV 179

  Fly   191 RQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN 255
            |.||..|.:      ....||||:|....|.:|||.|.|....|.|..|.:..||.|....:|..
  Fly   180 RLPKSMCYQ------NINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSG 238

  Fly   256 -SGILMDLLSYADWIKRVVRQYGPSTDMNRSLKK-WVDKI 293
             .|:..|:.:|..||..||.:..|.. :|...|. |..||
  Fly   239 LFGVYTDVNAYKSWIASVVLESEPRL-LNEYCKSDWGAKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 78/229 (34%)
Tryp_SPc 48..269 CDD:214473 76/226 (34%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 79/237 (33%)
Tryp_SPc 35..256 CDD:238113 80/239 (33%)
Tryp_SPc 273..467 CDD:214473 2/4 (50%)
Tryp_SPc 273..>368 CDD:304450 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463366
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.