DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Egfbp2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:266 Identity:67/266 - (25%)
Similarity:97/266 - (36%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQ 105
            |.|....||...:...|...|.|.|::..:|||||||..|.  ..|.||:          |.|.|
Mouse    30 NCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQ--YEVWLGK----------NKLFQ 82

  Fly   106 -EPFQEYN-VDMGFRHRYYNAN-----------DQTNDIGMLRLGRRVEYLNHIRPICI------ 151
             ||..::. |...|.|..:|.:           |.:||:.:|||.:..:..:.::||.:      
Mouse    83 EEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPK 147

  Fly   152 ------------FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWN 204
                        ....|:|:|.|....|.|.:                     |.|.|:::|...
Mouse   148 PGSKCLASGWGSITPTRWQKPDDLQCVFITLL---------------------PNENCAKVYLQK 191

  Fly   205 MTFEQICAGNT--LSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG---ILMDLLS 264
            :|...:|||..  ....|..|||.|.|       .|..:| |..|.....|...|   |..:|:.
Mouse   192 VTDVMLCAGEMGGGKDTCRDDSGGPLI-------CDGILQ-GTTSYGPVPCGKPGVPAIYTNLIK 248

  Fly   265 YADWIK 270
            :..|||
Mouse   249 FNSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/259 (25%)
Tryp_SPc 48..269 CDD:214473 62/256 (24%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 64/263 (24%)
Tryp_SPc 25..256 CDD:238113 67/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.