DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:270 Identity:69/270 - (25%)
Similarity:110/270 - (40%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV-- 78
            |.|.|.:..:|   .:|:.:|.|..|..:                |.|::|:|.:|||||||:  
Mosquito    42 RIVGGSKTTIE---SVPYQVSLRYFNNHI----------------CGGSIISHSWVLTAAHCLDW 87

  Fly    79 -PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEY 142
             |.:..||||.|    .|.......|       :.|.....|..|:.|:...|:..:|       
Mosquito    88 YPHNDEITVRTG----STSQSAGGSL-------HAVFYYHLHERYDPNEFQWDVATVR------- 134

  Fly   143 LNHIRPICIFASNRFQEPIDQLTWFT------TTVWRE-TAANATSKVLRTMNIDRQPKETCSEI 200
               :|......:.|...|:...|.:|      .|.|.. |||...:..|:.:.:|..|:|:|:..
Mosquito   135 ---VRTPMGLGAGRAPIPLATSTEWTVGERILVTGWGYLTAAGKVNDTLQMILLDAVPQESCNRT 196

  Fly   201 YGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLL 263
            :...:|.:.:|||......|:.|||.|.::    :|    ||.||.|.....|.|.  |:..::.
Mosquito   197 WTGFITADMLCAGGPGVDACAGDSGGPAVQ----DG----VQYGIVSWGSIDCGNGLPGVFTNIA 253

  Fly   264 --SYADWIKR 271
              |...:|:|
Mosquito   254 HPSVRSFIRR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/238 (26%)
Tryp_SPc 48..269 CDD:214473 59/234 (25%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 67/266 (25%)
Tryp_SPc 43..264 CDD:238113 68/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.