DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPA1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_320725.2 Gene:CLIPA1 / 1280858 VectorBaseID:AGAP011791 Length:440 Species:Anopheles gambiae


Alignment Length:298 Identity:69/298 - (23%)
Similarity:118/298 - (39%) Gaps:64/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCG--IPHNI-----SERSVNAKLAQNPWMAYL------ETPKGFHCSGTLINHLFVLTAAHCV 78
            |.||  .||.:     :.:...::..:.||...:      |:...:.|.|.||:...|||.|.|:
Mosquito   139 EGCGHRNPHGVIFTIENNQFSESEYGEYPWTVAIFARTKTESALKYLCGGALIDRAAVLTTASCL 203

  Fly    79 ----PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMG--FRHRYYNANDQTNDIGMLRLG 137
                .|...:.|||||::..|        .:||....:.:|.  :.|..|:...:.|||.::.||
Mosquito   204 HPYRSDVSSLVVRLGEWDMST--------VREPIPHIDSEMERIYLHPQYSMTSKVNDIAIVILG 260

  Fly   138 RRVEYLNH-IRPICIFASNRFQEPIDQL----TWFTTTVWRE-----TAANATSKVLRTMNIDRQ 192
            ..|| ||| :..:|:       .|...:    |..|...|.|     ........:|:...:...
Mosquito   261 DTVE-LNHTVGVVCL-------PPAGMVPSTGTDVTGVGWGEVPNFVVPRKLPQTILKKAQLHHL 317

  Fly   193 PKETCSEI--------YGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249
            ..|.|.:.        :..:.:|....|.:.....|..|:|:|.:.:. ..||:||..:|::|  
Mosquito   318 SHELCQQTLRKLMGRRFQLHSSFLCTTAQDAEMLPCRGDTGSPYMMET-VPGSERYYLVGLSS-- 379

  Fly   250 KG-QCQNSG---ILMDLLSYADWIKRVVRQYGPSTDMN 283
            .| .|....   :|.::..:.|||..|::    ..|:|
Mosquito   380 WGYDCNKQATPTVLTNVAYHRDWIDGVIK----GEDLN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/257 (24%)
Tryp_SPc 48..269 CDD:214473 59/254 (23%)
CLIPA1XP_320725.2 Tryp_SPc 159..404 CDD:238113 60/263 (23%)
Tryp_SPc 159..403 CDD:214473 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.