DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB11

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_319991.3 Gene:CLIPB11 / 1280172 VectorBaseID:AGAP009214 Length:359 Species:Anopheles gambiae


Alignment Length:288 Identity:96/288 - (33%)
Similarity:142/288 - (49%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLW-------RRVQGFQMLLEEDCGIPHNISERSV----NAKLAQNPWMAYLETPKG-FHCSG 63
            :||..       .|.:|...|..|.||.   .||..:    :|:|.|.||||.|:...| |.|.|
Mosquito    81 VCCKRAATGNKNNRERGLATLDLEGCGA---YSEDRIAFGQDARLFQYPWMALLKQRAGNFVCGG 142

  Fly    64 TLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCD--NHLCQEPFQEYNVDMGFRHRYYNAND 126
            ||||..:|||||||:.::.:.||||||::..|.:|||  ...|..|.|:..|:....|..|:|..
Mosquito   143 TLINERYVLTAAHCIKNNDITTVRLGEFDLSTPIDCDKRGEQCAPPPQDLFVEQTIVHEAYSARR 207

  Fly   127 QTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPI------DQLTWFTTTVWRETAANATSKVLR 185
            :.||||::||.:..||.:::.|||:        |:      .|.|:|... |..|.:..:|..|:
Mosquito   208 KENDIGLVRLAKEAEYNDNVLPICL--------PVTPAMRTTQTTYFVAG-WGATESAPSSNRLQ 263

  Fly   186 TMNIDRQPKETCSEIYGWNMTF-----EQICA-GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLG 244
            ...:.....:.|.:......:|     :|:|| |..|:..|:.|||.| ::.:..|.  ||||.|
Mosquito   264 FTKLSLLSNDQCVQKLLRVDSFAKVNNDQMCAIGANLTDNCTGDSGGP-LKTISINA--RYVQYG 325

  Fly   245 IAS---RVKGQCQNSGILMDLLSYADWI 269
            :.|   |..|:....|:...:.:|||||
Mosquito   326 VVSYGLRTCGKQSAPGVYTRVENYADWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 83/240 (35%)
Tryp_SPc 48..269 CDD:214473 81/238 (34%)
CLIPB11XP_319991.3 Tryp_SPc 113..353 CDD:214473 84/251 (33%)
Tryp_SPc 117..356 CDD:238113 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.