DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:251 Identity:69/251 - (27%)
Similarity:102/251 - (40%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYLET--PKGFHCSGTLINHLFVLTAAHCVP------DDLLITVRLGEYNTKTKVDCD---- 100
            ||||.|||  .....|.|:||:...:|||||||.      || .|..:..||::....:.|    
Mosquito    21 PWMALLETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDD-RIHFKDDEYDSGESEEADGAEY 84

  Fly   101 NHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASN--RFQEPIDQ 163
            :..|..|.|...::....|..|:|..:.||:.::||........::.|||:..:.  |...|.|.
Mosquito    85 SASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAIIGYNVIPICLPLTEQLRAYRPADS 149

  Fly   164 LTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQ-----------ICA-GNTL 216
            .    .|.|..|.....|.|||...:...|...|:      |..::           :|| ||..
Mosquito   150 F----VTGWGLTETGQRSAVLRYAILPALPLPDCA------MRIKELDRIIVLDDGHLCAGGNNR 204

  Fly   217 SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWI 269
            :..|..|||.|   ..:.:.|.|:|..|:.|.....|...   |:..::..:.|||
Mosquito   205 TAHCHGDSGGP---LQYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANVTHFIDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/251 (27%)
Tryp_SPc 48..269 CDD:214473 67/249 (27%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 67/249 (27%)
Tryp_SPc 9..257 CDD:238113 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.