DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP008911

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_319658.4 Gene:AgaP_AGAP008911 / 1279878 VectorBaseID:AGAP008911 Length:579 Species:Anopheles gambiae


Alignment Length:302 Identity:69/302 - (22%)
Similarity:126/302 - (41%) Gaps:64/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLW--RRVQGFQMLLEED---CG---IPHNISERSVNAKLAQNPWMAYLETPKG----FHCSGTL 65
            ||:  .:::|    .:||   ||   :..|....:.:|.....||.|.:...||    :.|.|::
Mosquito    14 CLYLVTQIRG----QDEDQLLCGRRKVQTNSMNNNGDAIAGHWPWYAAIYHRKGEKQEYACGGSI 74

  Fly    66 INHLFVLTAAHCV--PDDL----LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNA 124
            ::...:|||::||  |..:    |:||.:|:.:.|.        .....|.|:|.....|..::.
Mosquito    75 LDETTILTASNCVYTPSGVISAALVTVHVGQIHPKQ--------ASAYAQMYDVREIVVHPGFSE 131

  Fly   125 NDQTNDIGMLRLGRRV----EYLNHIRPICIFASNRFQEPI----DQLTWFTTTVWRETAANATS 181
            ....|||.:::|...:    ||   ::|:|::..:...|.|    ..:..|.....|:.   .:.
Mosquito   132 ASTINDIALIKLTASITLTTEY---VQPVCLWTMDSALELIVGRNGTVVGFGPNERRDV---VSG 190

  Fly   182 KVLRTMNIDRQPKETC----SEIYGWNMTFEQICAGNTLSQ---LCSTDSGAPQIRKMWHNGSDR 239
            :.|:...|.....:||    ..|:|.::..|..| |..|..   .|:.|||    ..::...|.:
Mosquito   191 EQLQQATIGVVDPQTCIASDPAIFGTHLPVETFC-GKGLQNGAGACNGDSG----DGLFFEVSGQ 250

  Fly   240 YVQLGIASRVKGQCQNSG--------ILMDLLSYADWIKRVV 273
            :...|:.:|::...::.|        :..|:..|.|||||.|
Mosquito   251 WFVRGLVARLQPVRESDGLCDPLQYTVYTDVAKYVDWIKRYV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/256 (23%)
Tryp_SPc 48..269 CDD:214473 55/253 (22%)
AgaP_AGAP008911XP_319658.4 Tryp_SPc 359..573 CDD:304450
Tryp_SPc 46..290 CDD:238113 58/262 (22%)
Tryp_SPc 46..288 CDD:214473 56/260 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.