DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG43336

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:263 Identity:103/263 - (39%)
Similarity:143/263 - (54%) Gaps:15/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GFQMLLEEDCGI-PHNISERSVN----AKLAQNPWMAYLETPKG-FHCSGTLINHLFVLTAAHCV 78
            |....|:..||| .|:.|...|.    |.|..:||||:|.:..| |.|.|:||.:..|||||||.
  Fly    17 GSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCF 81

  Fly    79 PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYN----VDMGFRHRYYNANDQTNDIGMLRLGRR 139
            .|...:..|||||:.:     :..:|.:.:..|.    |:.|||||:||......||.:|||.|:
  Fly    82 LDRTELVARLGEYDRE-----EYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRK 141

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWN 204
            |:|.::||||||....|:::.||.|...|.|.|.:|.:...|..|||:::.|:..|.|......:
  Fly   142 VQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYATLS 206

  Fly   205 MTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWI 269
            :|..|.||||..|.||:.|||.|....:.:..|.|:||:||||....||....:..|::||.|||
  Fly   207 LTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDWI 271

  Fly   270 KRV 272
            ..|
  Fly   272 LAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 92/228 (40%)
Tryp_SPc 48..269 CDD:214473 90/225 (40%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 93/238 (39%)
Tryp_SPc 40..271 CDD:238113 92/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463332
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.