DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG43110

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:267 Identity:80/267 - (29%)
Similarity:121/267 - (45%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRVQGFQMLLEEDCG---IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVL 72
            :|.|......:.|.|::.||   :|..||..:.:.:.||  :||.:.......|.||:|:..|||
  Fly    10 LCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQ--YMAGIFNTTHLLCGGTIIHEDFVL 72

  Fly    73 TAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLG 137
            |.|||.....|. ||||.||.       ||    |..:..|.....|..|:.:...|||.:::|.
  Fly    73 TVAHCKSTQTLF-VRLGAYNI-------NH----PTDQIRVIETIAHPQYSNSTYANDIALVKLE 125

  Fly   138 RRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYG 202
            |.|.:..:|:||||.......:   |:.::....|..|.....|.:|:.:.::|.....|....|
  Fly   126 RSVIFNLNIQPICIHLDATLGK---QIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLG 187

  Fly   203 WNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYAD 267
            .:...:||||.......|:.|||.|.|.|:.:.|.:...|.||.|....:|...|:..|:..|:.
  Fly   188 MSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSG 252

  Fly   268 WIKRVVR 274
            ||..:||
  Fly   253 WIANIVR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 67/223 (30%)
Tryp_SPc 48..269 CDD:214473 65/220 (30%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 69/235 (29%)
Tryp_SPc 36..257 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463364
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.