DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP009849

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_318962.4 Gene:AgaP_AGAP009849 / 1279267 VectorBaseID:AGAP009849 Length:356 Species:Anopheles gambiae


Alignment Length:286 Identity:84/286 - (29%)
Similarity:120/286 - (41%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRVQGFQMLLEEDCG----IPHNISERSVNAKLAQNPW--MAYLETPKGFHCSGTLINHL 69
            :||     ..||.  ::.||    .....|..|...:|.|.||  |..|...:...|||:||...
Mosquito    78 VCC-----AVFQS--DQTCGRLSQYADEFSFDSRETQLDQFPWAAMVLLRRVQKLVCSGSLIASR 135

  Fly    70 FVLTAAHCVPDDLLIT----VRLGEYNTKTKVDC----DNHLC--QEPFQEYNVDMGFRHRYY-- 122
            |||:||||..|....|    ||||:::.:...||    ...:|  |:|. :|.|:....|..:  
Mosquito   136 FVLSAAHCFVDVRGTTTDYRVRLGDWDLELDEDCLYVRGQLVCNEQQPV-DYAVERIISHGDFQR 199

  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTM 187
            ...|..:||.:|:|...|||...|.|.|:...| ...|:.....||...|..|  .:.|.|.|..
Mosquito   200 QRRDFLHDIALLKLAEAVEYGAQIGPACLPNWN-VGVPLIAGQKFTVFGWGRT--RSYSGVRRKY 261

  Fly   188 NIDRQPK--ETCSEIYGW---NMTFEQICAGNTL-SQLCSTDSGAPQIRKMWHNGSDRYVQLGIA 246
            .|:...:  ..|...||.   .:....:|.|... ..:|..|||...:|:    .|:|:||.||.
Mosquito   262 KIEMPGRNISACVRAYGLRAPEVPRIHLCVGGVYRKDVCHGDSGGALMRR----ESNRWVQEGIV 322

  Fly   247 SRVKGQCQN--SGILMDLLSYADWIK 270
            |....:|..  .|:..::..|.|||:
Mosquito   323 SFGAYRCGKPLPGVYTNVAHYIDWIQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/245 (30%)
Tryp_SPc 48..269 CDD:214473 72/242 (30%)
AgaP_AGAP009849XP_318962.4 Tryp_SPc 104..348 CDD:238113 75/251 (30%)
Tryp_SPc 104..347 CDD:214473 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.