DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPD2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_317284.4 Gene:CLIPD2 / 1277787 VectorBaseID:AGAP008183 Length:512 Species:Anopheles gambiae


Alignment Length:263 Identity:73/263 - (27%)
Similarity:122/263 - (46%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHN--ISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVP-----DDLL 83
            ||:.:.  .:||.|   ||...:.||:|.|.......|.|:||:.:.:|||||||.     |...
Mosquito   262 CGVKNGNPDTERIVGGHNADPNEWPWIAGLFNNGRQFCGGSLIDSIHILTAAHCVAHMSSYDVAR 326

  Fly    84 ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRP 148
            ::|:||::|.::..:. .|:      |..|....|||.:::....||:.:|.:.:.|.:...:||
Mosquito   327 LSVKLGDHNIRSNTEV-QHV------ERRVKRLVRHRGFDSRTLYNDVAVLTMDQAVPFTKQVRP 384

  Fly   149 ICIFASNRFQEPIDQLTWFTTTV--WRETAANATS-KVLRTMNIDRQPKETCSEIYG----WNMT 206
            ||:.|::..:    ..:..|.||  |.....|... .:|:.:|:.......|...||    ..:.
Mosquito   385 ICLPAADSTR----AYSGLTATVIGWGSLRENGPQPAILQEVNLPIWTNNECRIKYGPAAPGGII 445

  Fly   207 FEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYADW 268
            ...:|||......||.|||.|   .|.::|  ::.|:|:.|...| |   |..|:...:.::..|
Mosquito   446 DTMLCAGQAAKDSCSGDSGGP---LMVNDG--KWTQVGVVSWGIG-CGKGQYPGVYTRVTAFLPW 504

  Fly   269 IKR 271
            ||:
Mosquito   505 IKK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/239 (28%)
Tryp_SPc 48..269 CDD:214473 63/235 (27%)
CLIPD2XP_317284.4 Tryp_SPc 273..505 CDD:214473 67/248 (27%)
Tryp_SPc 274..508 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.