DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP008649

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_314746.4 Gene:AgaP_AGAP008649 / 1275498 VectorBaseID:AGAP008649 Length:312 Species:Anopheles gambiae


Alignment Length:261 Identity:64/261 - (24%)
Similarity:109/261 - (41%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG------IPHNISERSVN-AKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITV 86
            ||      :|:::.....| :.:.|.||||.|...:.|.|.|:|||..::|||||||       .
Mosquito    47 CGKVPNPPLPNSLRVIGGNTSDIDQYPWMAALYYRQQFTCGGSLINDRYILTAAHCV-------A 104

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQEY-NVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            |:.....:..:...|.:...|...: .|.....:||....: .||:.:|.|...|...:.:.|||
Mosquito   105 RMDAAGFEVYLRRPNIVTLNPEAVHRRVARIVMNRYQELRN-NNDVALLLLKEPVGVADGLVPIC 168

  Fly   151 IFASNRFQEPIDQLTW----FTTTVWRETAANATSKVLRTMNIDRQPKETC--SEIYGWNMTFEQ 209
            :        |:|...:    ...|.|..|.:...|:.|:.:.:.....:.|  |..:.:.:|.:.
Mosquito   169 L--------PVDGSNFDGKEAIVTGWGTTESGELSEHLQQLTVPILTNQQCRKSGYFRFQITAKM 225

  Fly   210 ICAGNTLS--QLCSTDSGAP-QIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWI 269
            :|||....  ..|..|||.| |:.|   ..:|:...:|:.|......|.:  |:...:..:..||
Mosquito   226 LCAGYLEGGRDSCQGDSGGPLQLAK---GETDQQQIVGVVSWGNECAQRNYPGVYARVTRFVSWI 287

  Fly   270 K 270
            :
Mosquito   288 R 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/235 (25%)
Tryp_SPc 48..269 CDD:214473 57/232 (25%)
AgaP_AGAP008649XP_314746.4 Tryp_SPc 60..287 CDD:214473 59/245 (24%)
Tryp_SPc 61..290 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.