DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:260 Identity:66/260 - (25%)
Similarity:107/260 - (41%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC-- 77
            |:  .||:.|:....|.|..:.|   .|.:|...|.. .:....:.|.|:||...|:||||||  
Mosquito    54 WK--DGFEGLVAPAYGNPALLRE---FAHIAAIGWTG-ADGKVNWGCGGSLIWENFILTAAHCAA 112

  Fly    78 ----VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGR 138
                ||.|:   .|:|:.|..:..|      .|..|:..:....||:.:..:.:..|:.:::|.:
Mosquito   113 NDEDVPPDV---ARMGDLNIYSDDD------DEFPQQLRIVKVIRHQQHRFSAKYYDVALMQLEK 168

  Fly   139 RVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKV-LRTMNIDRQPKETCSEIYG 202
            .:.....:.|.|::..:..:.|......:..|.:.|...|...|| |..||     ...||:.|.
Mosquito   169 NITVHETVAPACLWLDDEVRFPKLYAAGWGRTGFGEDKTNILLKVDLTPMN-----NTQCSKFYT 228

  Fly   203 WN-------MTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGI 258
            .:       :....:|||:.....|..|||.|...|:.||.......:|:.|..|  ||. |.|:
Mosquito   229 SSERGLRNGLHAHHLCAGDEKMDTCPGDSGGPLHVKLLHNAKMTPFLVGVTSFGKPCGQA-NPGV 292

  Fly   259  258
            Mosquito   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/227 (25%)
Tryp_SPc 48..269 CDD:214473 57/227 (25%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 62/245 (25%)
Tryp_SPc 67..295 CDD:238113 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.